Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM50001848
Substrate/Competitorn/a
Meas. Tech.ChEBML_145373
IC50 330±n/a nM
Citation Chandrakumar, NSYonan, PKStapelfeld, ASavage, MRorbacher, EContreras, PCHammond, D Preparation and opioid activity of analogues of the analgesic dipeptide 2,6-dimethyl-L-tyrosyl-N-(3-phenylpropyl)-D-alaninamide. J Med Chem35:223-33 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:KOR-1 | Kappa Opioid Receptor | OPIATE Kappa
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42692.90
Organism:Rattus norvegicus (rat)
Description:P34975
Residue:380
Sequence:
MESPIQIFRGEPGPTCAPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAVLSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV
RNTVQDPASMRDVGGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001848
NameBDBM50001848
Synonyms:2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-N-[1-methyl-2-(3-phenyl-propylamino)-ethyl]-propionamide | CHEMBL76527
TypeSmall organic molecule
Emp. Form.C23H33N3O2
Mol. Mass.383.527
SMILESC[C@H](CNCCCc1ccccc1)NC(=O)C(N)Cc1c(C)cc(O)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a