Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A1 receptor
LigandBDBM50003019
Substrate/Competitorn/a
Meas. Tech.ChEBML_29418
Ki 1.3±n/a nM
Citation Suzuki, FShimada, JNonaka, HIshii, AShiozaki, SIchikawa, SOno, E 7,8-Dihydro-8-ethyl-2-(3-noradamantyl)-4-propyl-1H-imidazo[2,1-i]purin-5(4H)-one: a potent and water-soluble adenosine A1 antagonist. J Med Chem35:3578-81 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A1 receptor
Name:Adenosine A1 receptor
Synonyms:A1 adenosine receptor | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | ADORA1 | Adenosine Receptor A1
Type:Enzyme Catalytic Domain
Mol. Mass.:36501.39
Organism:GUINEA PIG
Description:ADENOSINE A1 ADORA1 GUINEA PIG::P47745
Residue:326
Sequence:
MPHSVSAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIASLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAAVAIAGCWILSLVVGLTPMFGWNNLSKIEMAWAANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLSKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCHKPTILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPEPPIDEDLPEEKVDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003019
NameBDBM50003019
Synonyms:8-(Hexahydro-2,5-methano-pentalen-3a-yl)-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | CHEMBL52333 | KW-3902
TypeSmall organic molecule
Emp. Form.C20H28N4O2
Mol. Mass.356.4619
SMILESCCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)C12CC3CC1CC(C2)C3 |THB:22:21:18:24.23.25,22:23:18:21.20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a