Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase 1A1
LigandBDBM50003041
Substrate/Competitorn/a
Meas. Tech.ChEBML_31159
IC50 25000±n/a nM
Citation Lee, MJNagasawa, HTElberling, JADeMaster, EG Prodrugs of nitroxyl as inhibitors of aldehyde dehydrogenase. J Med Chem35:3648-52 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase 1A1
Name:Aldehyde dehydrogenase 1A1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:54465.59
Organism:Rattus norvegicus
Description:ChEMBL_31158
Residue:501
Sequence:
MSSPAQPAVPAPLANLKIQHTKIFINNEWHDSVSGKKFPVLNPATEEVICHVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATIEAINGGKVFANAYL
SDLGGSIKALKYCAGWADKIHGQTIPSDGDIFTFTRREPIGVCGQIIPWNFPLLMFIWKI
GPALSCGNTVVVKPAEQTPLTALHMASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVD
KVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQG
QCCVAASRIFVEESVYDEFVRKSVERAKKYVLGNPLTQGINQGPQIDKEQHDKILDLIES
GKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSIDDVIKR
ANNTTYGLAAGVFTKDLDRAITVSSALQAGVVWVNCYMILSAQCPFGGFKMSGNGRELGE
HGLYEYTELKTVAMKISQKNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003041
NameBDBM50003041
Synonyms:CHEMBL121472 | N-(benzoyloxy)-N-cyanobenzamide
TypeSmall organic molecule
Emp. Form.C15H10N2O3
Mol. Mass.266.2515
SMILESO=C(ON(C#N)C(=O)c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a