Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetType-1 angiotensin II receptor
LigandBDBM50003374
Substrate/Competitorn/a
Meas. Tech.ChEBML_36783
IC50 470±n/a nM
Citation Bradbury, RHAllott, CPDennis, MFisher, EMajor, JSMasek, BBOldham, AAPearce, RJRankine, NRevill, JM New nonpeptide angiotensin II receptor antagonists. 2. Synthesis, biological properties, and structure-activity relationships of 2-alkyl-4-(biphenylylmethoxy)quinoline derivatives. J Med Chem35:4027-38 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Type-1 angiotensin II receptor
Name:Type-1 angiotensin II receptor
Synonyms:AT1 | Angiotensin II type-1 receptor
Type:PROTEIN
Mol. Mass.:41004.19
Organism:Cavia porcellus
Description:ChEMBL_36783
Residue:359
Sequence:
MILNSSTEDGIKRIQDDCPKAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADICFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCVIIWLMAGLASLPAVIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFMFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKISDIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSTLSTKMSTLSYRPSDNVSSSAKKPVQCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003374
NameBDBM50003374
Synonyms:2,6-Dimethyl-4-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethoxy]-quinoline | CHEMBL130455
TypeSmall organic molecule
Emp. Form.C25H21N5O
Mol. Mass.407.4671
SMILESCc1ccc2nc(C)cc(OCc3ccc(cc3)-c3ccccc3-c3nnn[nH]3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a