Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1B
LigandBDBM30707
Substrate/Competitorn/a
Meas. Tech.ChEBML_1836
IC50 550±n/a nM
Citation Macor, JEBlake, JFox, CBJohnson, CKoe, BKLebel, LAMorrone, JMRyan, KSchmidt, AWSchulz, DW Synthesis and serotonergic pharmacology of the enantiomers of 3-[(N-methylpyrrolidin-2-yl)methyl]-5-methoxy-1H-indole: discovery of stereogenic differentiation in the aminoethyl side chain of the neurotransmitter serotonin. J Med Chem35:4503-5 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1B
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | S12 | Serotonin 1D beta receptor | Serotonin Receptor 1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:43579.17
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells
Residue:390
Sequence:
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM30707
NameBDBM30707
Synonyms:2-(5-methoxy-1H-indol-3-yl)-N,N-dimethyl-ethanamine | 2-(5-methoxy-1H-indol-3-yl)-N,N-dimethylethanamine | 2-(5-methoxy-1H-indol-3-yl)ethyl-dimethyl-amine | 3-(2-DIMETHYLAMINOETHYL)-5-METHOXYINDOLE | CHEMBL7257 | MLS000069438 | Methoxydimethyltryptamines | SMR000059066 | cid_1832
TypeSmall organic molecule
Emp. Form.C13H18N2O
Mol. Mass.218.2948
SMILESCOc1ccc2[nH]cc(CCN(C)C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a