Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 2 (5-HT2) receptor
LigandBDBM50081704
Substrate/Competitorn/a
Meas. Tech.ChEBML_1881
IC50 17±n/a nM
Citation Macor, JEBlake, JFox, CBJohnson, CKoe, BKLebel, LAMorrone, JMRyan, KSchmidt, AWSchulz, DW Synthesis and serotonergic pharmacology of the enantiomers of 3-[(N-methylpyrrolidin-2-yl)methyl]-5-methoxy-1H-indole: discovery of stereogenic differentiation in the aminoethyl side chain of the neurotransmitter serotonin. J Med Chem35:4503-5 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 2 (5-HT2) receptor
Name:Serotonin 2 (5-HT2) receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 1930
Components:This complex has 3 components.
Component 1
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:5-HT-2 | 5-HT-2A | 5-HT-S1A | 5-HT-S2 | 5-HT2 | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2A | Serotonin Receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52852.05
Organism:Rattus norvegicus (rat)
Description:Rat cortex membranes 5-HT2A receptors.
Residue:471
Sequence:
MEILCEDNISLSSIPNSLMQLGDGPRLYHNDFNSRDANTSEASNWTIDAENRTNLSCEGY
LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPALAYK
SSQLQVGQKKNSQEDAEQTVDDCSMVTLGKQQSEENCTDNIETVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Serotonin receptor 2a and 2b (5HT2A and 5HT2B)
Synonyms:5-HT2B | 5-hydroxytryptamine receptor 2B | HTR2B | Serotonin 2b (5-HT2b) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:53668.47
Organism:RAT
Description:5-HT2B HTR2B RAT::P30994
Residue:479
Sequence:
MASSYKMSEQSTISEHILQKTCDHLILTDRSGLKAESAAEEMKQTAENQGNTVHWAALLI
FAVIIPTIGGNILVILAVSLEKRLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEATW
PLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRTTAFVKITVVWL
ISIGIAIPVPIKGIEADVVNAHNITCELTKDRFGSFMLFGSLAAFFAPLTIMIVTYFLTI
HALRKKAYLVRNRPPQRLTRWTVSTVLQREDSSFSSPEKMVMLDGSHKDKILPNSTDETL
MRRMSSAGKKPAQTISNEQRASKVLGIVFLFFLLMWCPFFITNVTLALCDSCNQTTLKTL
LQIFVWVGYVSSGVNPLIYTLFNKTFREAFGRYITCNYQATKSVKVLRKCSSTLYFGNSM
VENSKFFTKHGIRNGINPAMYQSPVRLRSSTIQSSSIILLNTFLTENDGDKVEDQVSYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
Synonyms:5-HT2C | 5-hydroxytryptamine receptor 2C | 5-hydroxytryptamine receptor 2C (5HT2c) | HTR2C
Type:Enzyme
Mol. Mass.:51935.10
Organism:Rattus norvegicus (Rat)
Description:P08909
Residue:460
Sequence:
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS
IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV
WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW
AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY
VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG
TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY
VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH
TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50081704
NameBDBM50081704
Synonyms:5-Methoxy-3-((R)-1-methyl-pyrrolidin-2-ylmethyl)-1H-indole | CHEMBL137485
TypeSmall organic molecule
Emp. Form.C15H20N2O
Mol. Mass.244.3321
SMILESCOc1ccc2[nH]cc(C[C@H]3CCCN3C)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a