Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCatechol O-methyltransferase
LigandBDBM50004044
Substrate/Competitorn/a
Meas. Tech.ChEMBL_47059
Ki 17200±n/a nM
Citation Pérez, RAFernández-Alvarez, ENieto, OPiedrafita, FJ Dihydroxynitrobenzaldehydes and hydroxymethoxynitrobenzaldehydes: synthesis and biological activity as catechol-O-methyltransferase inhibitors. J Med Chem35:4584-8 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Catechol O-methyltransferase
Name:Catechol O-methyltransferase
Synonyms:COMT
Type:PROTEIN
Mol. Mass.:20586.58
Organism:Sus scrofa
Description:ChEMBL_105412
Residue:186
Sequence:
KERAMHVGRKKGQIVDTVVQEQRPSVLLELGAYCGYSAVRMARLLLPSARLLTIELNPDN
AAIAQQVVDFAGLQDRVTVVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLE
ECGLLRKGTVLLADNVICPGAPDFLAHVRGCGRFECTHFSSYLEYSQMVDGLEKAVYKGP
GSPAQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004044
NameBDBM50004044
Synonyms:3-Hydroxy-4-methoxy-5-nitro-benzaldehyde | CHEMBL89320
TypeSmall organic molecule
Emp. Form.C8H7NO5
Mol. Mass.197.1449
SMILESCOc1c(O)cc(C=O)cc1[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a