Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50004477
Substrate/Competitorn/a
Meas. Tech.ChEBML_49568
IC50 0.500000±n/a nM
Citation Holladay, MWBennett, MJTufano, MDLin, CWAsin, KEWitte, DGMiller, TRBianchi, BRNikkel, ALBednarz, L Synthesis and biological activity of CCK heptapeptide analogues. Effects of conformational constraints and standard modifications on receptor subtype selectivity, functional activity in vitro, and appetite suppression in vivo. J Med Chem35:2919-28 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:CCK-A receptor | CCK-AR | CCK1-R | Cholecystokinin receptor type A | Cholecystokinin-1 Receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:47859.34
Organism:Homo sapiens (Human)
Description:Stable expression of human CCK-1 receptors in HEK 293 cells.
Residue:428
Sequence:
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004477
NameBDBM50004477
Synonyms:CCK7 analogue | CHEMBL269016 | N-(1-Carbamoyl-2-phenyl-ethyl)-3-({2-[3-(1H-indol-3-yl)-2-(2-{2-[3-(4-sulfonyl-oxy-phenyl)-propionylamino]-hexanoylamino}-acetylamino)-propionylamino]-hexanoyl}-methyl-amino)-succinamic acid
TypeSmall organic molecule
Emp. Form.C48H62N8O13S
Mol. Mass.991.117
SMILESCCCC[C@H](NC(=O)CCc1ccc(OS(O)(=O)=O)cc1)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCC)C(=O)N(C)[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a