Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M3
LigandBDBM50004736
Substrate/Competitorn/a
Meas. Tech.ChEMBL_138302
EC50 2160±n/a nM
Citation Nilsson, BMVargas, HMHacksell, U Urea and 2-imidazolidone derivatives of the muscarinic agents oxotremorine and N-methyl-N-(1-methyl-4-pyrrolidino-2-butynyl)acetamide. J Med Chem35:3270-9 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M3
Name:Muscarinic acetylcholine receptor M3
Synonyms:GPM3 | Muscarinic acetylcholine receptor
Type:n/a
Mol. Mass.:66272.13
Organism:Cavia porcellus
Description:n/a
Residue:587
Sequence:
MTLHSNSTTLPLFPNISTSWIHSPSEAGLPPGTVTHFGSYNISQAAGNFSSLNGTTSDPL
GGHTIWQVVFIAFLTGFLALVTIIGNILVIVSFKVNKQLKHVNNYFLLSLADLIIGVISM
NLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTT
KRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYM
PVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSLKH
SSRRKYSRCHFWFATKSWKPNAGQMDQDHSSSDSWNNYDAAASLENSASDEEDIGSETRA
IYSIVLKLPGHSTILNSTKLPSSDNLQVPEEDLEPMDMERNASKPQTQKSMDDGGSFQKS
FSNLPIQLESTMDTAKTSDANSSVSKTMATLPLSFKEATLAKRFALRTRSQITKRKRMSL
IKEKRAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVC
YALCNKTFRNTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004736
NameBDBM50004736
Synonyms:1,3-Dimethyl-1-(4-pyrrolidin-1-yl-but-2-ynyl)-urea | CHEMBL321674
TypeSmall organic molecule
Emp. Form.C11H19N3O
Mol. Mass.209.2881
SMILESCNC(=O)N(C)CC#CCN1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a