Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGrowth hormone-releasing hormone receptor
LigandBDBM50004972
Substrate/Competitorn/a
Meas. Tech.ChEBML_72520
IC50 44±n/a nM
Citation Gaudreau, PBoulanger, LAbribat, T Affinity of human growth hormone-releasing factor (1-29)NH2 analogues for GRF binding sites in rat adenopituitary. J Med Chem35:1864-9 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Growth hormone-releasing hormone receptor
Name:Growth hormone-releasing hormone receptor
Synonyms:GHRH receptor | GRF receptor | GRFR
Type:PROTEIN
Mol. Mass.:51523.38
Organism:Rattus norvegicus
Description:ChEMBL_193173
Residue:464
Sequence:
MDSLLWATWVLCLLNLWGVALGHLHLECDFITQLRDDELACLQAAEGTNNSSMGCPGTWD
GLLCWPPTGSGQWVSLPCPEFFSHFGSDPGAVKRDCTITGWSDPFPPYPVACPVPLELLT
EEKSYFSTVKIIYTTGHSISIVALCVAIAILVALRRLHCPRNYIHTQLFATFILKASAVF
LKDAAVFQGDSTDHCSMSTILCKVSVAVSHFATMTNFSWLLAEAVYLSCLLASTSPRSKP
AFWWLVLAGWGLPVLCTGTWVGCKLAFEDTACWDLDDSSPYWWIIKGPIVLSVGVNFGLF
LNIICILLRKLGPAQGGLHTRAQYCNYLLPWSCPLPQVPRERTDLGPSSHEITVQESGTR
NCQLPWRLSKSTLLLIPLFGIHYIIFNFLPDSAGLGIRLPLELGLGSFQGFVVAVLYCFL
NQEVRTEISRKWYGHDPELLPARRTCTEWTTPPRSRVKVLTSEC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004972
NameBDBM50004972
Synonyms:CHEMBL427665 | GRF-analogues
TypeSmall organic molecule
Emp. Form.C149H244N46O39S
Mol. Mass.3335.881
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a