Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50005233
Substrate/Competitorn/a
Meas. Tech.ChEBML_164926
IC50 260±n/a nM
Citation Carceller, EMerlos, MGiral, MBartrolí, JGarcía-Rafanell, JForn, J 4-substituted 2-alkoxytetrahydrofurans as potent and long-lasting PAF antagonists. J Med Chem35:676-83 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005233
NameBDBM50005233
Synonyms:2-({Acetyl-[5-(3,3-diphenyl-propoxy)-tetrahydro-furan-3-ylmethoxycarbonyl]-amino}-methyl)-1-ethyl-pyridinium; iodide | CHEMBL158907
TypeSmall organic molecule
Emp. Form.C31H37N2O5
Mol. Mass.517.6353
SMILESCC[n+]1ccccc1CN(C(C)=O)C(=O)OCC1COC(C1)OCCC(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a