Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFree fatty acid receptor 2
LigandBDBM50074329
Substrate/Competitorn/a
Meas. Tech.ChEBML_1680678
EC50 250000±n/a nM
Citation Turroni, SBrigidi, PCavalli, ACandela, M Microbiota-Host Transgenomic Metabolism, Bioactive Molecules from the Inside. J Med Chem61:47-61 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Free fatty acid receptor 2
Name:Free fatty acid receptor 2
Synonyms:FFA2 | FFAR2 | G-protein coupled receptor 43 | GPCR43 | GPR43
Type:PROTEIN
Mol. Mass.:37156.44
Organism:Homo sapiens (Human)
Description:ChEMBL_1508993
Residue:330
Sequence:
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLL
LLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLS
RRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVR
LELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNV
SHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLG
RRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50074329
NameBDBM50074329
Synonyms:CH3-COOH | CHEMBL539 | Essigsaeure | Ethylic acid | HOAc | Methanecarboxylic acid | acetic acid | acide acetique | ethoic acid
TypeSmall organic molecule
Emp. Form.C2H4O2
Mol. Mass.60.052
SMILESCC(O)=O
Structure
n/a