Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycinamide ribonucleotide formyltransferase (GARFTase)
LigandBDBM50005736
Substrate/Competitorn/a
Meas. Tech.ChEBML_69927
IC50 6600±n/a nM
Citation Bigham, ECHodson, SJMallory, WRWilson, DDuch, DSSmith, GKFerone, R Synthesis and biological activity of open-chain analogues of 5,6,7,8-tetrahydrofolic acid--potential antitumor agents. J Med Chem35:1399-410 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycinamide ribonucleotide formyltransferase (GARFTase)
Name:Thymidylate synthase/GAR transformylase/AICAR transformylase
Synonyms:GAR Tfase | GAR transformylase | Glycinamide ribonucleotide transformylase (GAR Tfase)
Type:Protein
Mol. Mass.:107768.47
Organism:Homo sapiens (Human)
Description:P22102
Residue:1010
Sequence:
MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNTAISISDHTALAQ
FCKEKKIEFVVVGPEAPLAAGIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIP
TAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAF
GAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAP
QVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQV
ILPLLKSDLYEVIQSTLDGLLCTSLPVWLENHTALTVVMASKGYPGDYTKGVEITGFPEA
QALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLISALEEAKKGLAAIKFEGAIYRKD
VGFRAIAFLQQPRSLTYKESGVDIAAGNMLVKKIQPLAKATSRSGCKVDLGGFAGLFDLK
AAGFKDPLLASGTDGVGTKLKIAQLCNKHDTIGQDLVAMCVNDILAQGAEPLFFLDYFSC
GKLDLSVTEAVVAGIAKACGKAGCALLGGETAEMPDMYPPGEYDLAGFAVGAMERDQKLP
HLERITEGDVVVGIASSGLHSNGFSLVRKIVAKSSLQYSSPAPDGCGDQTLGDLLLTPTR
IYSHSLLPVLRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPRVFSWLQQEG
HLSEEEMARTFNCGVGAVLVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPRVKVKN
LIESMQINGSVLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV
ISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILS
GPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEA
VPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005736
NameBDBM50005736
Synonyms:2-{2-Chloro-4-[3-(2,4-diamino-6-oxo-1,6-dihydro-pyrimidin-5-yl)-propylamino]-benzoylamino}-pentanedioic acid | CHEMBL417304
TypeSmall organic molecule
Emp. Form.C19H23ClN6O6
Mol. Mass.466.876
SMILESNc1nc(N)c(CCCNc2ccc(C(=O)NC(CCC(O)=O)C(O)=O)c(Cl)c2)c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a