Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAICAR transformylase
LigandBDBM50005520
Substrate/Competitorn/a
Meas. Tech.ChEBML_28431
IC50 94000±n/a nM
Citation Bigham, ECHodson, SJMallory, WRWilson, DDuch, DSSmith, GKFerone, R Synthesis and biological activity of open-chain analogues of 5,6,7,8-tetrahydrofolic acid--potential antitumor agents. J Med Chem35:1399-410 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AICAR transformylase
Name:Thymidylate synthase/GAR transformylase/AICAR transformylase
Synonyms:5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase | 5-aminoimidazole-4-carboxamide-ribonucleotide transformylase | ATIC | Aminoimidazole carboxamide ribonucleotide transformylase (AICAR Tfase) | Bifunctional purine biosynthesis protein PURH | IMP cyclohydrolase | IMP synthetase | Inosinicase | Phosphoribosylaminoimidazolecarboxamide formyltransferase
Type:Protein
Mol. Mass.:64616.62
Organism:Homo sapiens (Human)
Description:P31939
Residue:592
Sequence:
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFT
HTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINL
CDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPIS
AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNG
NYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIV
ATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKT
GVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDA
FFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005520
NameBDBM50005520
Synonyms:(S)-2-{4-[3-(2,4-Diamino-6-oxo-1,6-dihydro-pyrimidin-5-yl)-propylamino]-benzoylamino}-pentanedioic acid | 2-{4-[3-(2,4-Diamino-6-oxo-1,6-dihydro-pyrimidin-5-yl)-propylamino]-benzoylamino}-pentanedioic acid | CHEMBL13659
TypeSmall organic molecule
Emp. Form.C19H24N6O6
Mol. Mass.432.4305
SMILESNc1nc(N)c(CCCNc2ccc(cc2)C(=O)N[C@@H](CCC(O)=O)C(O)=O)c(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a