Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50006702
Substrate/Competitorn/a
Meas. Tech.ChEMBL_28996
Ki 220±n/a nM
Citation Shimada, JSuzuki, FNonaka, HIshii, AIchikawa, S (E)-1,3-dialkyl-7-methyl-8-(3,4,5-trimethoxystyryl)xanthines: potent and selective adenosine A2 antagonists. J Med Chem35:2342-5 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006702
NameBDBM50006702
Synonyms:7-Methyl-1,3-dipropyl-8-((E)-styryl)-3,7-dihydro-purine-2,6-dione | 7-Methyl-1,3-dipropyl-8-styryl-3,7-dihydro-purine-2,6-dione | CHEMBL312079
TypeSmall organic molecule
Emp. Form.C20H24N4O2
Mol. Mass.352.4302
SMILESCCCn1c2nc(\C=C\c3ccccc3)n(C)c2c(=O)n(CCC)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a