Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor (KOR)
LigandBDBM50007001
Substrate/Competitorn/a
Meas. Tech.ChEMBL_145370
IC50 85±n/a nM
Citation Freeman, JPMichalson, ETD'Andrea, SVBaczynskyj, LVon Voigtlander, PFLahti, RASmith, MWLawson, CFScahill, TAMizsak, SA Naphtho and benzo analogues of the kappa opioid agonist trans-(+/-)-3,4-dichloro-N-methyl-N-[2-(1-pyrrolidinyl)cyclohexyl] benzeneacetamide. J Med Chem34:1891-6 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kappa-type opioid receptor (KOR)
Name:Opioid receptor
Synonyms:KOR-1 | Kappa-type opioid receptor | MSL-1 | OPIATE Kappa | OPRK1
Type:Enzyme
Mol. Mass.:42656.78
Organism:Mus musculus (Mouse)
Description:P33534
Residue:380
Sequence:
MESPIQIFRGDPGPTCSPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLESAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRV
RNTVQDPASMRDVGGMNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007001
NameBDBM50007001
Synonyms:3,4-Dichloro-N-methyl-N-(3-pyrrolidin-1-yl-1,2,3,4-tetrahydro-anthracen-2-yl)-benzamide | CHEMBL294231
TypeSmall organic molecule
Emp. Form.C26H26Cl2N2O
Mol. Mass.453.403
SMILESCN([C@@H]1Cc2cc3ccccc3cc2C[C@H]1N1CCCC1)C(=O)c1ccc(Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a