Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50007400
Substrate/Competitorn/a
Meas. Tech.ChEMBL_201281
Ki 0.800000±n/a nM
Citation Glennon, RAYousif, MYIsmaiel, AMel-Ashmawy, MBHerndon, JLFischer, JBServer, ACHowie, KJ Novel 1-phenylpiperazine and 4-phenylpiperidine derivatives as high-affinity sigma ligands. J Med Chem34:3360-5 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007400
NameBDBM50007400
Synonyms:4-Phenyl-1-(4-phenyl-butyl)-piperidine | 4-Phenyl-1-(4-phenyl-butyl)-piperidine: maleate | CHEMBL1788131 | CHEMBL325238
TypeSmall organic molecule
Emp. Form.C21H27N
Mol. Mass.293.4458
SMILESC(CCc1ccccc1)CN1CCC(CC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a