Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNMDA receptor subunit 2C (GluN2C)
LigandBDBM50007401
Substrate/Competitorn/a
Meas. Tech.ChEBML_154220
IC50>10000±n/a nM
Citation Glennon, RAYousif, MYIsmaiel, AMel-Ashmawy, MBHerndon, JLFischer, JBServer, ACHowie, KJ Novel 1-phenylpiperazine and 4-phenylpiperidine derivatives as high-affinity sigma ligands. J Med Chem34:3360-5 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NMDA receptor subunit 2C (GluN2C)
Name:Glutamate NMDA receptor; Grin1/Grin2c
Synonyms:Glutamate receptor ionotropic, NMDA 2C
Type:Protein
Mol. Mass.:135305.94
Organism:Rattus norvegicus (Rat)
Description:Q00961
Residue:1237
Sequence:
MGGALGPALLLTSLLGAWARLGAGQGEQAVTVAVVFGSSGPLQTQARTRLTSQNFLDLPL
EIQPLTVGVNNTNPSSILTQICGLLGAARVHGIVFEDNVDTEAVAQLLDFVSSQTHVPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASYLSWRLLDVLTLELGPGGPRARTQRLLRQVDAPVLVAYCSREEAEVLFAEA
AQAGLVGPGHVWLVPNLALGSTDAPPAAFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HSYRRQYGTLPAPAGDCRSHPGPVSPAREAFYRHLLNVTWEGRDFSFSPGGYLVRPTMVV
IALNRHRLWEMVGRWDHGVLYMKYPVWPRYSTSLQPVVDSRHLTVATLEERPFVIVESPD
PGTGGCVPNTVPCRRQSNHTFSSGDLTPYTKLCCKGFCIDILKKLAKVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFVETGISVMVSRSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTKGKKPGGPSFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQL
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVY
WKLRHSVPNSSQLDFLLAFSRGIYSCFNGVQSLPSPARPPSPDLTADSAQANVLKMLQAA
RDMVNTADVSSSLDRATRTIENWGNNRRVPAPTASGPRSSTPGPPGQPSPSGWGPPGGGR
TPLARRAPQPPARPATCGPPLPDVSRPSCRHASDARWPVRVGHQGPHVSASERRALPERS
LLPAHCHYSSFPRAERSGRPYLPLFPEPPEPDDLPLLGPEQLARREAMLRAAWARGPRPR
HASLPSSVAEAFTRSNPLPARCTGHACACPCPQSRPSCRHLAQAQSLRLPSYPEACVEGV
PAGVATWQPRQHVCLHAHTRLPFCWGTVCRHPPPCTSHSPWLIGTWEPPAHRVRTLGLGT
GYRDSGVLEEVSREACGTQGFPRSCTWRRVSSLESEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007401
NameBDBM50007401
Synonyms:1-Phenyl-4-(4-phenyl-butyl)-piperazine | CHEMBL85879
TypeSmall organic molecule
Emp. Form.C20H26N2
Mol. Mass.294.4338
SMILESC(CCc1ccccc1)CN1CCN(CC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a