Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(4) dopamine receptor
LigandBDBM50004770
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1691084
Ki 8.3±n/a nM
Citation Del Bello, FBonifazi, AGiannella, MGiorgioni, GPiergentili, APetrelli, RCifani, CMicioni Di Bonaventura, MVKeck, TMMazzolari, AVistoli, GCilia, APoggesi, EMatucci, RQuaglia, W The replacement of the 2-methoxy substituent of N-((6,6-diphenyl-1,4-dioxan-2-yl)methyl)-2-(2-methoxyphenoxy)ethan-1-amine improves the selectivity for 5-HT Eur J Med Chem125:233-244 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D(4) dopamine receptor
Name:D(4) dopamine receptor
Synonyms:D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:467
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG
LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP
PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC
PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004770
NameBDBM50004770
Synonyms:CHEMBL2312227
TypeSmall organic molecule
Emp. Form.C26H29NO4
Mol. Mass.419.5128
SMILESCOc1ccccc1OCCNCC1COCC(O1)(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a