Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-adrenergic receptor
LigandBDBM50010556
Substrate/Competitorn/a
Meas. Tech.ChEBML_196404
Ki 195000±n/a nM
Citation Leftheris, KGoodman, M Synthesis and beta-adrenergic antagonist activity of stereoisomeric practolol and propranolol derivatives. J Med Chem33:216-23 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-adrenergic receptor
Name:Beta-adrenergic receptor
Synonyms:Beta-2 adrenergic receptor | Beta-2 adrenoceptor | Beta-2 adrenoreceptor
Type:PROTEIN
Mol. Mass.:47002.38
Organism:Mus musculus
Description:ChEMBL_196404
Residue:418
Sequence:
MGPHGNDSDFLLAPNGSRAPDHDVTQERDEAWVVGMAILMSVIVLAIVFGNVLVITAIAK
FERLQTVTNYFIISLACADLVMGLAVVPFGASHILMKMWNFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKK
AIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF
HAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRD
NLIPKEVYILLNWLGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSSSKTYGNGYSSNSNG
RTDYTGEPNTCQLGQEREQELLCEDPPGMEGFVNCQGTVPSLSVDSQGRNCSTNDSPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010556
NameBDBM50010556
Synonyms:6-[2-Hydroxy-3-(naphthalen-1-yloxy)-propylamino]-heptanoic acid p-tolylamide(R,S) | CHEMBL308698
TypeSmall organic molecule
Emp. Form.C27H34N2O3
Mol. Mass.434.5705
SMILESC[C@@H](CCCCC(=O)Nc1ccc(C)cc1)NC[C@@H](O)COc1cccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a