Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmu/kappa opioid receptor
LigandBDBM50010701
Substrate/Competitorn/a
Meas. Tech.ChEBML_146979
IC50 0.362000±n/a nM
Citation Kawasaki, AMKnapp, RJKramer, THWire, WSVasquez, OSYamamura, HIBurks, TFHruby, VJ Design and synthesis of highly potent and selective cyclic dynorphin A analogues. J Med Chem33:1874-9 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
mu/kappa opioid receptor
Name:mu/kappa opioid receptor
Synonyms:Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:OPIATE Mu OPRM1 GUINEA PIG::P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010701
NameBDBM50010701
Synonyms:CHEMBL410616 | H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-D-Cys-Arg-Pro-Lys-Leu-D-Cys-NH2
TypeSmall organic molecule
Emp. Form.C69H112N24O14S2
Mol. Mass.1565.91
SMILESCC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]1CSSC[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]2CCCN2C(=O)[C@H](CCCNC(N)=N)NC1=O)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a