Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT2
LigandBDBM50011977
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36493
IC50 1±n/a nM
Citation Weinstock, JKeenan, RMSamanen, JHempel, JFinkelstein, JAFranz, RGGaitanopoulos, DEGirard, GRGleason, JGHill, DT 1-(carboxybenzyl)imidazole-5-acrylic acids: potent and selective angiotensin II receptor antagonists. J Med Chem34:1514-7 (1991) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT2
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41346.62
Organism:RAT
Description:Angiotensin II AT2 0 0::P35351
Residue:363
Sequence:
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011977
NameBDBM50011977
Synonyms:(E)-2-butyl-1-(p-carboxybenzyl)-alpha-2-thenylimidazole-5-acrylic acid | (E)-3-[2-n-butyl-1-{(4-carboxyphenyl)methyl}-1H-imidazol-5-yl]-2-(2-thienyl)methyl-2-propenoic acid | (E)-alpha{[2-butyl-1-[(4-carboxyphenyl)methyl]-1H-imidazole-5-yl]methylene}-2-thiopheneproprionic acid | 4-({2-butyl-5-[(1E)-2-carboxy-3-(2-thienyl)prop-1-en-1-yl]-1H-imidazol-1-yl}methyl)benzoic acid | CHEMBL813 | EPROSARTAN
TypeSmall organic molecule
Emp. Form.C23H24N2O4S
Mol. Mass.424.513
SMILESCCCCc1ncc(\C=C(/Cc2cccs2)C(O)=O)n1Cc1ccc(cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a