Reaction Details |
 | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM8125 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1709400 |
---|
IC50 | 0.060000±n/a nM |
---|
Citation | Bai, X; Yang, Z; Zhu, M; Dong, B; Zhou, L; Zhang, G; Wang, J; Wang, Y Design and synthesis of potent HIV-1 protease inhibitors with (S)-tetrahydrofuran-tertiary amine-acetamide as P2-ligand: Structure-activity studies and biological evaluation. Eur J Med Chem137:30-44 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM8125 |
---|
Name | BDBM8125 |
Synonyms: | (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl N-[(2S,3R)-4-[(4-aminobenzene)(2-methylpropyl)sulfonamido]-3-hydroxy-1-phenylbutan-2-yl]carbamate | CHEMBL1323 | Darunavir | Darunavir (DRV) | TMC-114 | UIC-94017 | US10806794, Compound Darunavir |
Type | Small organic molecule |
Emp. Form. | C27H37N3O7S |
Mol. Mass. | 547.664 |
SMILES | [H][C@@]1(CO[C@@]2([H])OCC[C@@]12[H])OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(N)cc1 |r| |
Structure |  |
n/a |
---|