Reaction Details |
 | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM13934 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1721669 |
---|
IC50 | 40±n/a nM |
---|
Citation | Bungard, CJ; Williams, PD; Schulz, J; Wiscount, CM; Holloway, MK; Loughran, HM; Manikowski, JJ; Su, HP; Bennett, DJ; Chang, L; Chu, XJ; Crespo, A; Dwyer, MP; Keertikar, K; Morriello, GJ; Stamford, AW; Waddell, ST; Zhong, B; Hu, B; Ji, T; Diamond, TL; Bahnck-Teets, C; Carroll, SS; Fay, JF; Min, X; Morris, W; Ballard, JE; Miller, MD; McCauley, JA Design and Synthesis of Piperazine Sulfonamide Cores Leading to Highly Potent HIV-1 Protease Inhibitors. ACS Med Chem Lett8:1292-1297 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM13934 |
---|
Name | BDBM13934 |
Synonyms: | Atazanavir | BMS 232632 | CGP 73547 | CHEMBL1163 | Latazanavir | US10806794, Compound Atazanavir | methyl N-[(1S)-1-[[(2S,3S)-3-hydroxy-4-[[[(2S)-2-(methoxycarbonylamino)-3,3-dimethyl-butanoyl]amino]-[(4-pyridin-2-ylphenyl)methyl]amino]-1-phenyl-butan-2-yl]carbamoyl]-2,2-dimethyl-propyl]carbamate | methyl N-[(1S)-1-{[(2S,3S)-3-hydroxy-4-[(2S)-2-[(methoxycarbonyl)amino]-3,3-dimethyl-N'-{[4-(pyridin-2-yl)phenyl]methyl}butanehydrazido]-1-phenylbutan-2-yl]carbamoyl}-2,2-dimethylpropyl]carbamate |
Type | Small organic molecule |
Emp. Form. | C38H52N6O7 |
Mol. Mass. | 704.8555 |
SMILES | COC(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)CN(Cc1ccc(cc1)-c1ccccn1)NC(=O)[C@@H](NC(=O)OC)C(C)(C)C)C(C)(C)C |r| |
Structure |  |
n/a |
---|