Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 receptor (V2)
LigandBDBM50020673
Substrate/Competitorn/a
Meas. Tech.ChEBML_215180
Ki 1±n/a nM
Citation Huffman, WFAlbrightson-Winslow, CBrickson, BBryan, HGCaldwell, NDytko, GEggleston, DSKinter, LBMoore, MLNewlander, KA A minor modification of residue 1 in potent vasopressin antagonists dramatically reduces agonist activity. J Med Chem32:880-4 (1989) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 receptor (V2)
Name:Vasopressin receptor
Synonyms:AVPR V2 | AVPR2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2 | Vasopressin V2 receptor
Type:Receptor
Mol. Mass.:40295.28
Organism:Homo sapiens (Human)
Description:P30518
Residue:371
Sequence:
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020673
NameBDBM50020673
Synonyms:1-[19-Benzyl-13-carbamoylmethyl-22-(4-ethoxy-benzyl)-16-isopropyl-12,15,18,21,24-pentaoxo-7,8-dithia-11,14,17,20,23-pentaaza-spiro[5.19]pentacosane-10-carbonyl]-pyrrolidine-2-carboxylic acid [1-(carbamoylmethyl-carbamoyl)-4-guanidino-butyl]-amide | CHEMBL438014
TypeSmall organic molecule
Emp. Form.C53H77N13O11S2
Mol. Mass.1136.389
SMILESCCOc1ccc(C[C@@H]2NC(=O)CC3(CCCCC3)SSC[C@@H](NC(=O)[C@@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](Cc3ccccc3)NC2=O)C(C)C)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a