Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM50016886
Substrate/Competitorn/a
Meas. Tech.ChEBML_33027
IC50 1020±n/a nM
Citation Hutchison, AWilliams, Mde Jesus, RStone, GASylvester, LClarke, FHSills, MA 2H-[1]benzopyrano[3,4-b]pyridines: synthesis and activity at central monoamine receptors. J Med Chem32:720-7 (1989) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
adrenergic Alpha2
Name:Cerebral cortex alpha adrenergic receptor
Synonyms:Alpha-2A adrenergic receptor | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | Alpha-2D adrenergic receptor | Alpha-2Da adrenergic receptor | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha2A | adrenergic Alpha2D
Type:Enzyme Catalytic Domain
Mol. Mass.:49275.13
Organism:BOVINE
Description:adrenergic Alpha2 0 BOVINE::Q28838
Residue:452
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISFEKKRGRSG
QPSAEPRCEINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDATA
AELPGSAERRPNGLGPERGGVGPVGAEVESLQVQLNGAPGEPAPAGAGADALDLEESSSS
EHAERPPGSRRSERGPRAKGKARASQVKPGDSLPRRGPGATGLGAPTAGPAEERSGGGAK
ASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAIGCPVPPTLFKFFFWFGYCN
SSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50016886
NameBDBM50016886
Synonyms:1,5-Dimethyl-2,3,4,4a,10,10a-hexahydro-1H-9-oxa-1-aza-phenanthren-8-ol | CHEMBL422024
TypeSmall organic molecule
Emp. Form.C14H19NO2
Mol. Mass.233.3062
SMILESCN1CCC[C@H]2[C@H]1COc1c(O)ccc(C)c21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a