Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChemokine CXCL12
LigandBDBM50369279
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1736474
Kd 780±n/a nM
Citation Regenass, PAbboud, DDaubeuf, FLehalle, CGizzi, PRiché, SHachet-Haas, MRohmer, FGasparik, VBoeglin, DHaiech, JKnehans, TRognan, DHeissler, DMarsol, CVilla, PGalzi, JLHibert, MFrossard, NBonnet, D Discovery of a Locally and Orally Active CXCL12 Neutraligand (LIT-927) with Anti-inflammatory Effect in a Murine Model of Allergic Airway Hypereosinophilia. J Med Chem61:7671-7686 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chemokine CXCL12
Name:Chemokine CXCL12
Synonyms:n/a
Type:Enzyme
Mol. Mass.:10677.83
Organism:Homo sapiens (Human)
Description:P48061
Residue:93
Sequence:
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50369279
n/a
NameBDBM50369279
Synonyms:CHEMBL4166454
TypeSmall organic molecule
Emp. Form.C17H13ClN2O3
Mol. Mass.328.75
SMILESCOc1cc(ccc1O)-c1cc(nc(=O)[nH]1)-c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: