Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlanine racemase
LigandBDBM50019385
Substrate/Competitorn/a
Meas. Tech.ChEBML_30523
Ki 8500000±n/a nM
Citation Vo-Quang, YCarniato, DVo-Quang, LLacoste, AMNeuzil, ELe Goffic, F (1-Amino-2-propenyl) phosphonic acid, an inhibitor of alanine racemase and D-alanine:D-alanine ligase. J Med Chem29:579-81 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alanine racemase
Name:Alanine racemase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39155.52
Organism:Escherichia coli (strain K12)
Description:ChEMBL_30522
Residue:359
Sequence:
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW
MKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019385
NameBDBM50019385
Synonyms:(1-Amino-allyl)-phosphonic acid | CHEMBL154711
TypeSmall organic molecule
Emp. Form.C3H8NO3P
Mol. Mass.137.0743
SMILESCCC(=N)P(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a