Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 receptor
LigandBDBM50020655
Substrate/Competitorn/a
Meas. Tech.ChEMBL_215034
Ki 1.2±n/a nM
Citation Huffman, WFAli, FEBryan, WMCallahan, JFMoore, MLSilvestri, JSYim, NCKinter, LBMcDonald, JEAshton-Shue, D Novel vasopressin analogues that help define a minimum effective antagonist pharmacophore. J Med Chem28:1759-60 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 receptor
Name:Vasopressin V2 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40556.17
Organism:Sus scrofa
Description:ChEMBL_214870
Residue:370
Sequence:
MLRATTSAVPRALSWPAAPGNGSEREPLDDRDPLLARVELALLSTVFVAVALSNGLVLGA
LVRRGRRGRWAPMHVFIGHLCLADLAVALFQVLPQLAWDATYRFRGPDALCRAVKYLQMV
GMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQR
DVGDGSGVLDCWASFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHTSLVPGPA
ERAGGHRGGRRAGSPREGARVSAAMAKTARMTLVIVAVYVLCWAPFFLVQLWSVWDPKAP
REGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATA
SSFSARDTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020655
NameBDBM50020655
Synonyms:CHEMBL408474 | [6-Amino-2-({1-[19-amino-13-benzyl-10-(2-carbamoyl-ethyl)-7-carbamoylmethyl-16-(4-hydroxy-benzyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaaza-cycloicosane-4-carbonyl]-pyrrolidine-2-carbonyl}-amino)-hexanoylamino]-acetic acid
TypeSmall organic molecule
Emp. Form.C46H64N12O13S2
Mol. Mass.1057.203
SMILESNCCCC[C@H](NC(=O)[C@H]1CCCN1C(=O)[C@@H]1CSSC[C@@H](N)C(=O)N[C@H](Cc2ccc(O)cc2)C(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N1)C(=O)NCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a