Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 receptor
LigandBDBM50020665
Substrate/Competitorn/a
Meas. Tech.ChEBML_31442
Ki 2.7±n/a nM
Citation Ali, FEBryan, WChang, HLHuffman, WFMoore, MLHeckman, GKinter, LBMcDonald, JSchmidt, DShue, D Potent vasopressin antagonists lacking the proline residue at position 7. J Med Chem29:984-8 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 receptor
Name:Vasopressin V2 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40556.17
Organism:Sus scrofa
Description:ChEMBL_214870
Residue:370
Sequence:
MLRATTSAVPRALSWPAAPGNGSEREPLDDRDPLLARVELALLSTVFVAVALSNGLVLGA
LVRRGRRGRWAPMHVFIGHLCLADLAVALFQVLPQLAWDATYRFRGPDALCRAVKYLQMV
GMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQR
DVGDGSGVLDCWASFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHTSLVPGPA
ERAGGHRGGRRAGSPREGARVSAAMAKTARMTLVIVAVYVLCWAPFFLVQLWSVWDPKAP
REGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATA
SSFSARDTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50020665
NameBDBM50020665
Synonyms:13-(2-Amino-ethyl)-19-benzyl-22-(4-ethoxy-benzyl)-16-isopropyl-12,15,18,21,24-pentaoxo-7,8-dithia-11,14,17,20,23-pentaaza-spiro[5.19]pentacosane-10-carboxylic acid [1-(carbamoylmethyl-carbamoyl)-4-guanidino-butyl]-amide | CHEMBL409054
TypeSmall organic molecule
Emp. Form.C48H72N12O9S2
Mol. Mass.1025.29
SMILESCCOc1ccc(C[C@@H]2NC(=O)CC3(CCCCC3)SSC[C@@H](NC(=O)[C@@H](CCN)NC(=O)[C@@H](NC(=O)[C@@H](Cc3ccccc3)NC2=O)C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(N)=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a