Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3',5'-cyclic phosphodiesterase
LigandBDBM50457942
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1761125
IC50 115900±n/a nM
Citation Ch?o?-Rzepa, GJankowska, A?lusarczyk, M?wierczek, APociecha, KWyska, EBucki, AGawalska, AKo?aczkowski, MPaw?owski, M Novel butanehydrazide derivatives of purine-2,6-dione as dual PDE4/7 inhibitors with potential anti-inflammatory activity: Design, synthesis and biological evaluation. Eur J Med Chem146:381-394 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3',5'-cyclic phosphodiesterase
Name:3',5'-cyclic phosphodiesterase
Synonyms:Phosphodiesterase 7 (PDE7) | Phosphodiesterase 7A | Phosphodiesterase 7A (PDE7A1)
Type:Enzyme
Mol. Mass.:55514.96
Organism:Homo sapiens (Human)
Description:Q13946
Residue:482
Sequence:
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS
SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL
HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW
DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC
ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENR
LS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50457942
n/a
NameBDBM50457942
Synonyms:CHEMBL4217546
TypeSmall organic molecule
Emp. Form.C25H27N7O5
Mol. Mass.505.5258
SMILESCn1c2nc(NCc3ccccc3)n(CCCC(=O)N\N=C\c3ccc(O)cc3O)c2c(=O)n(C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: