Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhizopuspepsin
LigandBDBM50022287
Substrate/Competitorn/a
Meas. Tech.ChEBML_222282
Ki 29±n/a nM
Citation Salituro, FGAgarwal, NHofmann, TRich, DH Inhibition of aspartic proteinases by peptides containing lysine and ornithine side-chain analogues of statine. J Med Chem30:286-95 (1987) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Rhizopuspepsin
Name:Rhizopuspepsin
Synonyms:Rhizopuspepsin
Type:PROTEIN
Mol. Mass.:41326.43
Organism:Rhizopus microsporus var. chinensis
Description:ChEMBL_100244
Residue:393
Sequence:
MKFTLISSCIAIAALAVAVDAAPGEKKISIPLAKNPNYKPSAKNAIQKAIAKYNKHKINT
STGGIVPDAGVGTVPMTDYGNDVEYYGQVTIGTPGKKFNLDFDTGSSDLWIASTLCTNCG
SRQTKYDPKQSSTYQADGRTWSISYGDGSSASGILAKDNVNLGGLLIKGQTIELAKREAA
SFANGPNDGLLGLGFDTITTVRGVKTPMDNLISQGLISRPIFGVYLGKASNGGGGEYIFG
GYDSTKFKGSLTTVPIDNSRGWWGITVDRATVGTSTVASSFDGILDTGTTLLILPNNVAA
SVARAYGASDNGDGTYTISCDTSRFKPLVFSINGASFQVSPDSLVFEEYQGQCIAGFGYG
NFDFAIIGDTFLKNNYVVFNQGVPEVQIAPVAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022287
n/a
NameBDBM50022287
Synonyms:8-Acetylamino-3-hydroxy-4-{3-methyl-2-[3-methyl-2-(3-methyl-butyrylamino)-butyrylamino]-butyrylamino}-octanoic acid ethyl ester | CHEMBL98552
TypeSmall organic molecule
Emp. Form.C27H50N4O7
Mol. Mass.542.7085
SMILESCCOC(=O)C[C@H](O)[C@H](CCCCNC(C)=O)NC(=O)[C@H](NC(=O)C(NC(=O)CC(C)C)C(C)C)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: