Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin D Synthase
LigandBDBM50463721
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1779224
Kd 0.140000±n/a nM
Citation Takaya, DInaka, KOmura, ATakenuki, KKawanishi, MYabuki, YNakagawa, YTsuganezawa, KOgawa, NWatanabe, CHonma, TAritake, KUrade, YShirouzu, MTanaka, A Characterization of crystal water molecules in a high-affinity inhibitor and hematopoietic prostaglandin D synthase complex by interaction energy studies. Bioorg Med Chem26:4726-4734 (2018) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin D Synthase
Name:Prostaglandin D Synthase
Synonyms:Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | Prostaglandin D
Type:Enzyme
Mol. Mass.:23341.07
Organism:Homo sapiens (Human)
Description:The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag.
Residue:199
Sequence:
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50463721
NameBDBM50463721
Synonyms:CHEMBL4238290
TypeSmall organic molecule
Emp. Form.C20H17N5O2
Mol. Mass.359.3813
SMILESO=C(Nc1ccc(cc1)N1CCCC1=O)c1cnc(nc1)-c1ccccn1
Structure
n/a