Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDihydrofolate reductase
LigandBDBM50226274
Substrate/Competitorn/a
Meas. Tech.ChEMBL_53612
IC50 19±n/a nM
Citation DeGraw, JIChristie, PHTagawa, HKisliuk, RLGaumont, YSchmid, FASirotnak, FM Synthesis and biological activity of resolved C-10 diastereomers of 10-methyl- and 10-ethyl-10-deazaminopterin. J Med Chem29:1056-61 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dihydrofolate reductase
Name:Dihydrofolate reductase
Synonyms:1.5.1.3 | DHFR
Type:n/a
Mol. Mass.:21652.69
Organism:Gallus gallus (Chicken)
Description:n/a
Residue:189
Sequence:
VRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNAVIMGKKTWFSI
PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAV
YKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLTEYPGVPADIQEEDGIQYKFE
VYQKSVLAQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50226274
NameBDBM50226274
Synonyms:CHEMBL3349020
TypeSmall organic molecule
Emp. Form.C22H25N7O5
Mol. Mass.467.4778
SMILESCC[C@H](Cc1cnc2nc(N)nc(N)c2n1)c1ccc(cc1)C(=O)N[C@@H](CCC(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a