Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetWD repeat-containing protein 5
LigandBDBM50465591
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1785273
Ki 219±n/a nM
Citation Wang, FJeon, KOSalovich, JMMacdonald, JDAlvarado, JGogliotti, RDPhan, JOlejniczak, ETSun, QWang, SCamper, DYuh, JPShaw, JGSai, JRossanese, OWTansey, WPStauffer, SRFesik, SW Discovery of Potent 2-Aryl-6,7-dihydro-5 H-pyrrolo[1,2- a]imidazoles as WDR5-WIN-Site Inhibitors Using Fragment-Based Methods and Structure-Based Design. J Med Chem61:5623-5642 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
WD repeat-containing protein 5
Name:WD repeat-containing protein 5
Synonyms:WD repeat-containing protein 5 | WD repeat-containing protein 5 (WDR5) | WD repeat-containing protein 5 (WRD5)
Type:Protein
Mol. Mass.:36597.13
Organism:Homo sapiens (Human)
Description:P61964
Residue:334
Sequence:
MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWL
ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN
RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKL
WDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH
TDVVISTACHPTENIIASAALENDKTIKLWKSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50465591
NameBDBM50465591
Synonyms:CHEMBL4294825
TypeSmall organic molecule
Emp. Form.C25H27N3O2
Mol. Mass.401.5008
SMILESCOc1cccc(c1)C(=O)N(CC1CC1)Cc1cccc(c1)-c1cn2CCCc2n1
Structure
n/a