Reaction Details |
 | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50469417 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1804115 |
---|
Ki | 0.001200±n/a nM |
---|
Citation | Ghosh, AK; Williams, JN; Ho, RY; Simpson, HM; Hattori, SI; Hayashi, H; Agniswamy, J; Wang, YF; Weber, IT; Mitsuya, H Design and Synthesis of Potent HIV-1 Protease Inhibitors Containing Bicyclic Oxazolidinone Scaffold as the P2 Ligands: Structure-Activity Studies and Biological and X-ray Structural Studies. J Med Chem61:9722-9737 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50469417 |
---|
Name | BDBM50469417 |
Synonyms: | CHEMBL4293023 |
Type | Small organic molecule |
Emp. Form. | C28H37N3O8S |
Mol. Mass. | 575.674 |
SMILES | [H][C@]12C[C@H](C[C@@]1([H])OC(=O)N2)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r| |
Structure |  |
n/a |
---|