Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alpha isoform
LigandBDBM50473785
Substrate/Competitorn/a
Meas. Tech.ChEMBL_162010
Kd 1096±n/a nM
Citation Ishchenko, AVShakhnovich, EI SMall Molecule Growth 2001 (SMoG2001): an improved knowledge-based scoring function for protein-ligand interactions. J Med Chem45:2770-80 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alpha isoform
Name:Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alpha isoform
Synonyms:Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
Type:PROTEIN
Mol. Mass.:56194.06
Organism:Homo sapiens (Human)
Description:ChEMBL_161424
Residue:486
Sequence:
MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET
EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL
SNTSAE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50473785
n/a
NameBDBM50473785
Synonyms:CHEMBL94507
TypeSmall organic molecule
Emp. Form.C10H17N4O19P5
Mol. Mass.652.1262
SMILESO[C@@H]1[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(=O)OP(O)(=O)OP(O)(O)=O)O[C@H]([C@@H]1O)n1cnc2cncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: