Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtease
LigandBDBM50476647
Substrate/Competitorn/a
Meas. Tech.ChEMBL_445720
Ki 0.270000±n/a nM
Citation Wang, YFTie, YBoross, PITozser, JGhosh, AKHarrison, RWWeber, IT Potent new antiviral compound shows similar inhibition and structural interactions with drug resistant mutants and wild type HIV-1 protease. J Med Chem50:4509-15 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protease
Name:Protease
Synonyms:n/a
Type:Enzyme
Mol. Mass.:10904.79
Organism:Human immunodeficiency virus 1 (HIV-1)
Description:Q9YQ12
Residue:99
Sequence:
PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50476647
NameBDBM50476647
Synonyms:CHEMBL178593 | GRL-98065
TypeSmall organic molecule
Emp. Form.C28H36N2O9S
Mol. Mass.576.658
SMILES[H][C@@]12CCO[C@]1([H])OC[C@@H]2OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc2OCOc2c1 |r|
Structure
n/a