| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50476647 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_445720 |
|---|
| Ki | 0.270000±n/a nM |
|---|
| Citation |  Wang, YF; Tie, Y; Boross, PI; Tozser, J; Ghosh, AK; Harrison, RW; Weber, IT Potent new antiviral compound shows similar inhibition and structural interactions with drug resistant mutants and wild type HIV-1 protease. J Med Chem50:4509-15 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50476647 |
|---|
| Name | BDBM50476647 |
|---|
| Synonyms: | CHEMBL178593 | GRL-98065 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36N2O9S |
|---|
| Mol. Mass. | 576.658 |
|---|
| SMILES | [H][C@@]12CCO[C@]1([H])OC[C@@H]2OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc2OCOc2c1 |r| |
|---|
| Structure |  |
|---|
| n/a |
|---|
Search and Browse
