Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtease
LigandBDBM50479982
Substrate/Competitorn/a
Meas. Tech.ChEMBL_544292
Ki 8.0±n/a nM
Citation Hazen, RHarvey, RFerris, RCraig, CYates, PGriffin, PMiller, JKaldor, IRay, JSamano, VFurfine, ESpaltenstein, AHale, MTung, RSt Clair, MHanlon, MBoone, L In vitro antiviral activity of the novel, tyrosyl-based human immunodeficiency virus (HIV) type 1 protease inhibitor brecanavir (GW640385) in combination with other antiretrovirals and against a panel of protease inhibitor-resistant HIV. Antimicrob Agents Chemother51:3147-54 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protease
Name:Protease
Synonyms:n/a
Type:Enzyme
Mol. Mass.:10904.79
Organism:Human immunodeficiency virus 1 (HIV-1)
Description:Q9YQ12
Residue:99
Sequence:
PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50479982
NameBDBM50479982
Synonyms:Aptivus | CHEBI:63628 | TIPRANAVIR | Tipranavir | U-140690 | US10806794, Compound Tipranavir
TypeSmall organic molecule
Emp. Form.C31H33F3N2O5S
Mol. Mass.602.664
SMILESCCC[C@@]1(CCc2ccccc2)CC(O)=C([C@H](CC)c2cccc(NS(=O)(=O)c3ccc(cn3)C(F)(F)F)c2)C(=O)O1 |t:15|
Structure
n/a