Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIntegrase
LigandBDBM50483529
Substrate/Competitorn/a
Meas. Tech.ChEMBL_727385
IC50 52481±n/a nM
Citation Sharma, HPatil, SSanchez, TWNeamati, NSchinazi, RFBuolamwini, JK Synthesis, biological evaluation and 3D-QSAR studies of 3-keto salicylic acid chalcones and related amides as novel HIV-1 integrase inhibitors. Bioorg Med Chem19:2030-45 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Integrase
Name:Integrase
Synonyms:Integrase
Type:PROTEIN
Mol. Mass.:32203.43
Organism:Human immunodeficiency virus 1
Description:ChEMBL_106649
Residue:288
Sequence:
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50483529
NameBDBM50483529
Synonyms:CHEMBL1682058
TypeSmall organic molecule
Emp. Form.C17H10BrF3O5
Mol. Mass.431.158
SMILESOC(=O)c1cc(Br)cc(C(=O)\C=C\c2cccc(OC(F)(F)F)c2)c1O
Structure
n/a