Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase
LigandBDBM50029133
Substrate/Competitorn/a
Meas. Tech.ChEMBL_30809
pH7±n/a
Ki 8000±n/a nM
Commentsextracted
Citation Grant, AJLerner, LM Heat-induced formation of alpha,beta-unsaturated nucleoside dialdehydes and their activity with adenosine deaminase. J Med Chem23:795-8 (1980) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine deaminase
Name:Adenosine deaminase
Synonyms:ADA | Adenosine aminohydrolase
Type:Enzyme
Mol. Mass.:40910.44
Organism:Bos taurus (bovine)
Description:n/a
Residue:363
Sequence:
MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPE
FLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAI
DLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGY
HTLEDATLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIF
KSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPASAE
QCL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029133
NameBDBM50029133
Synonyms:(2R)-2-[(1S)-1-(6-amino-9H-purin-9-yl)-2-oxoethoxy]-3-hydroxypropanal | CHEMBL349866
TypeSmall organic molecule
Emp. Form.C10H11N5O4
Mol. Mass.265.2254
SMILESNc1ncnc2n(cnc12)[C@@H](O[C@H](CO)C=O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a