Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 protease
LigandBDBM50485740
Substrate/Competitorn/a
Meas. Tech.ChEMBL_858488
Ki 0.377000±n/a nM
Citation Parai, MKHuggins, DJCao, HNalam, MNAli, ASchiffer, CATidor, BRana, TM Design, synthesis, and biological and structural evaluations of novel HIV-1 protease inhibitors to combat drug resistance. J Med Chem55:6328-41 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HIV-1 protease
Name:HIV-1 protease
Synonyms:HIV-1 | HIV-1 protease | protease
Type:PROTEIN
Mol. Mass.:10795.19
Organism:Human immunodeficiency virus
Description:ChEMBL_118439
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50485740
NameBDBM50485740
Synonyms:CHEMBL2165903
TypeSmall organic molecule
Emp. Form.C28H36N4O6S2
Mol. Mass.588.739
SMILESCC[C@H](C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)OC[C@@H]1CCC(=O)N1)S(=O)(=O)c1ccc2ncsc2c1 |r|
Structure
n/a