Reaction Details |
 | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50485740 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_858662 |
---|
Ki | 0.003000±n/a nM |
---|
Citation | Parai, MK; Huggins, DJ; Cao, H; Nalam, MN; Ali, A; Schiffer, CA; Tidor, B; Rana, TM Design, synthesis, and biological and structural evaluations of novel HIV-1 protease inhibitors to combat drug resistance. J Med Chem55:6328-41 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50485740 |
---|
Name | BDBM50485740 |
Synonyms: | CHEMBL2165903 |
Type | Small organic molecule |
Emp. Form. | C28H36N4O6S2 |
Mol. Mass. | 588.739 |
SMILES | CC[C@H](C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)OC[C@@H]1CCC(=O)N1)S(=O)(=O)c1ccc2ncsc2c1 |r| |
Structure |  |
n/a |
---|