Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium-transporting ATPase
LigandBDBM50032094
Substrate/Competitorn/a
Meas. Tech.ChEMBL_76069
IC50 67±n/a nM
Citation Ife, RJBrown, THBlurton, PKeeling, DJLeach, CAMeeson, MLParsons, METheobald, CJ Reversible inhibitors of the gastric (H+/K+)-ATPase. 5. Substituted 2,4-diaminoquinazolines and thienopyrimidines. J Med Chem38:2763-73 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Potassium-transporting ATPase
Name:Potassium-transporting ATPase
Synonyms:Potassium-transporting ATPase alpha chain 1/beta chain
Type:n/a
Mol. Mass.:n/a
Description:n/a
Components:This complex has 0 components.
Component 1
Name:Potassium-transporting ATPase
Synonyms:ATP4B | Gastric H(+)/K(+) ATPase subunit beta | Potassium-transporting ATPase beta chain | Potassium-transporting ATPase subunit beta | Proton pump beta chain | gp60-90
Type:n/a
Mol. Mass.:33083.09
Organism:Sus scrofa (Pig)
Description:n/a
Residue:290
Sequence:
MAALQEKKSCSQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMSGIFALCIY
VLMRTIDPYTPDYQDQLKSPGVTLRPDVYGEKGLDISYNVSDSTTWAGLAHTLHRFLAGY
SPAAQEGSINCTSEKYFFQESFLAPNHTKFSCKFTADMLQNCSGRPDPTFGFAEGKPCFI
IKMNRIVKFLPGNSTAPRVDCAFLDQPRDGPPLQVEYFPANGTYSLHYFPYYGKKAQPHY
SNPLVAAKLLNVPRNRDVVIVCKILAEHVSFDNPHDPYEGKVEFKLKIQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Potassium-transporting ATPase
Synonyms:ATP4A | Gastric H(+)/K(+) ATPase subunit alpha | H+/K+-ATPase | Potassium-transporting ATPase | Potassium-transporting ATPase alpha chain 1 | Proton pump
Type:Enzyme
Mol. Mass.:114279.23
Organism:Sus scrofa (Pig)
Description:P19156
Residue:1034
Sequence:
MGKAENYELYQVELGPGPSGDMAAKMSKKKAGRGGGKRKEKLENMKKEMEINDHQLSVAE
LEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAI
CLIAFAIQASEGDLTTDDNLYLALALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQAT
VIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILQAQGRKVDNSSLTGESEPQTRSPE
CTHESPLETRNIAFFSTMCLEGTAQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIEH
FVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAKR
LASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHSADTTEDQSGQT
FDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGY
RERFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHVLVMKGAPERVLERCSSILIKGQELPL
DEQWREAFQTAYLSLGGLGERVLGFCQLYLSEKDYPPGYAFDVEAMNFPTSGLSFAGLVS
MIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLRV
PVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLGA
IVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFD
NLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAESD
IMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRPQW
ENHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEMCQIADVLIRKTRRLSAFQQGFF
RNRILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPMPFGLLIFVYDEIRKLGV
RCCPGSWWDQELYY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032094
NameBDBM50032094
Synonyms:CHEMBL92968 | N*2*,N*4*-Dimethyl-N*2*,N*4*-diphenyl-quinazoline-2,4-diamine
TypeSmall organic molecule
Emp. Form.C22H20N4
Mol. Mass.340.421
SMILESCN(c1ccccc1)c1nc(N(C)c2ccccc2)c2ccccc2n1
Structure
n/a