Reaction Details |
 | Report a problem with these data |
Target | Isoprenylcysteine carboxyl methyltransferase |
---|
Ligand | BDBM50034280 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158698 |
---|
Ki | 8000±n/a nM |
---|
Citation | Marciano, D; Ben-Baruch, G; Marom, M; Egozi, Y; Haklai, R; Kloog, Y Farnesyl derivatives of rigid carboxylic acids-inhibitors of ras-dependent cell growth. J Med Chem38:1267-72 (1995) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Isoprenylcysteine carboxyl methyltransferase |
---|
Name: | Isoprenylcysteine carboxyl methyltransferase |
Synonyms: | n/a |
Type: | PROTEIN |
Mol. Mass.: | 26663.61 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_158698 |
Residue: | 232 |
Sequence: | ALLLLLYRPPHYQIAIRACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFHYSEYLVTT
VNNPKSLSLDSFLLNHSLEYTVAALSSWIEFTLENIFWPELKQITWLSAAGLLMVIFGEC
LRKVAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIGTQVMLCNPIC
GVVYALTVWRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKGVKVGL
|
|
|
BDBM50034280 |
---|
Name | BDBM50034280 |
Synonyms: | 2-Chloro-5-((2E,6E)-3,7,11-trimethyl-dodeca-2,6,10-trienylamino)-benzoic acid | CHEMBL23751 |
Type | Small organic molecule |
Emp. Form. | C22H30ClNO2 |
Mol. Mass. | 375.932 |
SMILES | [#6]\[#6](-[#6])=[#6]/[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#7]-c1ccc(Cl)c(c1)-[#6](-[#8])=O |
Structure |
|
n/a |
---|