Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsoprenylcysteine carboxyl methyltransferase
LigandBDBM50034280
Substrate/Competitorn/a
Meas. Tech.ChEMBL_158698
Ki 8000±n/a nM
Citation Marciano, DBen-Baruch, GMarom, MEgozi, YHaklai, RKloog, Y Farnesyl derivatives of rigid carboxylic acids-inhibitors of ras-dependent cell growth. J Med Chem38:1267-72 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Isoprenylcysteine carboxyl methyltransferase
Name:Isoprenylcysteine carboxyl methyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:26663.61
Organism:Rattus norvegicus
Description:ChEMBL_158698
Residue:232
Sequence:
ALLLLLYRPPHYQIAIRACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFHYSEYLVTT
VNNPKSLSLDSFLLNHSLEYTVAALSSWIEFTLENIFWPELKQITWLSAAGLLMVIFGEC
LRKVAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIGTQVMLCNPIC
GVVYALTVWRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKGVKVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034280
NameBDBM50034280
Synonyms:2-Chloro-5-((2E,6E)-3,7,11-trimethyl-dodeca-2,6,10-trienylamino)-benzoic acid | CHEMBL23751
TypeSmall organic molecule
Emp. Form.C22H30ClNO2
Mol. Mass.375.932
SMILES[#6]\[#6](-[#6])=[#6]/[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#7]-c1ccc(Cl)c(c1)-[#6](-[#8])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a