Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic elastase
LigandBDBM50034581
Substrate/Competitorn/a
Meas. Tech.ChEMBL_152315
Ki 22.8±n/a nM
Citation Deadman, JJElgendy, SGoodwin, CAGreen, DBaban, JAPatel, GSkordalakes, EChino, NClaeson, GKakkar, VV Characterization of a class of peptide boronates with neutral P1 side chains as highly selective inhibitors of thrombin. J Med Chem38:1511-22 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic elastase
Name:Pancreatic elastase
Synonyms:Elastase 2A | Elastase-2 | Elastase-2A
Type:PROTEIN
Mol. Mass.:28705.23
Organism:Sus scrofa
Description:ChEMBL_156951
Residue:269
Sequence:
MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034581
NameBDBM50034581
Synonyms:CHEMBL36744 | Peptide boronate
TypeSmall organic molecule
Emp. Form.C43H54BN3O7
Mol. Mass.735.716
SMILESCOCCCC(NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)OCc1ccccc1)C(c1ccccc1)c1ccccc1)B1O[C@@H]2CC3CC(C3(C)C)[C@]2(C)O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a