Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtease
LigandBDBM50489369
Substrate/Competitorn/a
Meas. Tech.ChEMBL_937806
Ki 0.500000±n/a nM
Citation Zhang, HWang, YFShen, CHAgniswamy, JRao, KVXu, CXGhosh, AKHarrison, RWWeber, IT Novel P2 tris-tetrahydrofuran group in antiviral compound 1 (GRL-0519) fills the S2 binding pocket of selected mutants of HIV-1 protease. J Med Chem56:1074-83 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protease
Name:Protease
Synonyms:n/a
Type:Enzyme
Mol. Mass.:10904.79
Organism:Human immunodeficiency virus 1 (HIV-1)
Description:Q9YQ12
Residue:99
Sequence:
PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50489369
NameBDBM50489369
Synonyms:CHEMBL1232930 | GRL-0519
TypeSmall organic molecule
Emp. Form.C30H40N2O9S
Mol. Mass.604.712
SMILES[H][C@@]12OCC[C@]1([H])[C@@]1([H])[C@H](CO[C@@]1([H])O2)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc(OC)cc1 |r|
Structure
n/a