Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT2
LigandBDBM50035431
Substrate/Competitorn/a
Meas. Tech.ChEMBL_36654
IC50 23000±n/a nM
Citation Chang, LLAshton, WTFlanagan, KLChen, TBO'Malley, SSZingaro, GJSiegl, PKKivlighn, SDLotti, VJChang, RS Triazolinone biphenylsulfonamides as angiotensin II receptor antagonists with high affinity for both the AT1 and AT2 subtypes. J Med Chem37:4464-78 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT2
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41346.62
Organism:RAT
Description:Angiotensin II AT2 0 0::P35351
Residue:363
Sequence:
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50035431
NameBDBM50035431
Synonyms:5-Butyl-4-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-2-(2-trifluoromethyl-phenyl)-2,4-dihydro-[1,2,4]triazol-3-one | 5-Butyl-4-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-2-(2-trifluoromethyl-phenyl)-2,4-dihydro-[1,2,4]triazol-3-one | CHEMBL19018
TypeSmall organic molecule
Emp. Form.C27H24F3N7O
Mol. Mass.519.521
SMILESCCCCc1nn(-c2ccccc2C(F)(F)F)c(=O)n1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a