Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50491839
Substrate/Competitorn/a
Meas. Tech.ChEMBL_963350
Ki 12±n/a nM
Citation Kusakabe, KIso, YTada, YSakagami, MMorioka, YChomei, NShinonome, SKawamoto, KTakenaka, HYasui, KHamana, HHanasaki, K Selective CB2 agonists with anti-pruritic activity: discovery of potent and orally available bicyclic 2-pyridones. Bioorg Med Chem21:3154-63 (2013) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:Brain-type cannabinoid receptor | CANNABINOID CB1 | CB-R | CB1 | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor
Type:Enzyme
Mol. Mass.:52842.52
Organism:Mus musculus (Mouse)
Description:P47746
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50491839
NameBDBM50491839
Synonyms:CHEMBL2387183
TypeSmall organic molecule
Emp. Form.C22H34N2O2
Mol. Mass.358.5176
SMILESCCCCn1c2CCCCCCc2cc(C(=O)NC2CCCCC2)c1=O
Structure
n/a