Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM50029257
Substrate/Competitorn/a
Meas. Tech.ChEMBL_62900
Ki 1.8±n/a nM
Citation Reitz, ABBennett, DJBlum, PSCodd, EEMaryanoff, CAOrtegon, MERenzi, MJScott, MKShank, RPVaught, JL A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem37:1060-2 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptor
Name:Dopamine receptor D2 and D3
Synonyms:D(3) dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor
Type:Protein
Mol. Mass.:49540.58
Organism:Rattus norvegicus (Rat)
Description:P19020
Residue:446
Sequence:
MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI
CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ
QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK
RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP
LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV
NSALNPVIYTTFNVEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029257
NameBDBM50029257
Synonyms:(3-((4-(2-isopropoxyphenyl)piperazin-1-yl)methyl)phenyl)(piperidin-1-yl)methanone | CHEMBL10085 | RWJ-377796 | mazapertine | {3-[4-(2-Isopropoxy-phenyl)-piperazin-1-ylmethyl]-phenyl}-piperidin-1-yl-methanone
TypeSmall organic molecule
Emp. Form.C26H35N3O2
Mol. Mass.421.575
SMILESCC(C)Oc1ccccc1N1CCN(Cc2cccc(c2)C(=O)N2CCCCC2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a